IGF-1 LR3
Long R3 IGF-1: 83-residue analogue with reduced IGF-binding-protein affinity.
Peptide Calculator
Calculate reconstitution values for this 10mg vial.
Verify your vial
Enter the 6-character code from the card in your box.
For laboratory research use only. Not for human or veterinary consumption, diagnostic or therapeutic use. Handle in accordance with institutional safety procedures.
Product Overview
Scientific profile
IGF-1 LR3 (Long R3 Insulin-like Growth Factor-1) is an 83-amino-acid analogue of human IGF-1 comprising the complete IGF-1 sequence with an arginine substitution for glutamic acid at position 3 and a 13-residue N-terminal extension peptide.
Research Background
The R3 substitution and N-terminal extension markedly reduce binding to IGF-binding proteins (IGFBPs), which normally sequester native IGF-1. As a result, IGF-1 LR3 displays substantially greater apparent potency in cell-culture systems and is widely used as a defined growth-factor supplement in serum-free media and biomanufacturing (e.g., CHO cell culture). It signals through the type-1 IGF receptor (IGF-1R) and the downstream PI3K–Akt and MAPK pathways.
Areas of Investigation
- IGF-1R signalling, cell proliferation and survival assays
- Serum-free cell-culture media and bioprocess optimisation
- IGFBP biology and growth-factor bioavailability
- Skeletal-muscle cell differentiation models
Analytical Profile
Purity by reverse-phase HPLC; identity confirmed by ESI-MS (deconvoluted mass of the folded, disulfide-bonded protein). Supplied as a lyophilized solid.
Specifications
Chemical & physical data
CAS Number
946870-92-4
Molecular Formula
C400H619N111O115S9
Molecular Weight
9111.45 g/mol (folded, 3 disulfides)
Physical Form
Lyophilized Powder
Storage Guidelines
-20°C, desiccated and protected from light
Amino Acid Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
13-residue N-terminal extension + IGF-1 (Glu3→Arg) · Disulfides: Cys19–Cys61, Cys31–Cys74, Cys60–Cys65
Quality Assurance
Every vial. Every batch. Documented.
Our release process is built for research reproducibility — independent analytics, traceable batches and tamper-evident authentication.
>99% Purity Guaranteed
Every batch must exceed 99% purity by reverse-phase HPLC before it is released to the catalog.
3rd Party Laboratory Tested
Independent analytical labs confirm purity by HPLC and molecular identity by mass spectrometry (MS).
Batch-Tracked Serialization
Each box carries a unique 6-character code linked to its production batch and verifiable online.
Strict Research-Grade Synthesis
Solid-phase synthesis, lyophilization and sealed vialing under controlled, documented conditions.
Continue exploring
Related compounds
HGH 191AASOMATROPIN
4mg (12 IU)Recombinant 191-amino-acid human growth hormone, identical to the pituitary 22 kDa isoform.
View details
IPAMORELIN
10mgSelective pentapeptide growth-hormone secretagogue and ghrelin-receptor agonist.
View details
CJC-1295 WITHOUT DACMOD GRF 1-29
10mgTetrasubstituted GHRH(1–29) amide — Modified GRF 1-29, without the Drug Affinity Complex.
View details
TESAMORELIN
10mgN-terminally trans-3-hexenoyl-modified analogue of full-length human GHRH(1–44).
View details